Lineage for d2j55b_ (2j55 B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. Protein Amicyanin [49505] (2 species)
  7. Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. Domain d2j55b_: 2j55 B: [138014]
    Other proteins in same PDB: d2j55h_, d2j55j_, d2j55l1, d2j55m_
    automated match to d1aac__
    complexed with cu, gol

Details for d2j55b_

PDB Entry: 2j55 (more details), 2.15 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase o-quinone in complex with amicyanin.
PDB Compounds: (B:) amicyanin

SCOPe Domain Sequences for d2j55b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j55b_ b.6.1.1 (B:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOPe Domain Coordinates for d2j55b_ are not available.

Timeline for d2j55b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j55a_, d2j55h_, d2j55j_, d2j55l1, d2j55m_