Class b: All beta proteins [48724] (180 folds) |
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) |
Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
Protein Ribosomal protein L25 [50717] (1 species) |
Species Escherichia coli [TaxId:562] [50718] (32 PDB entries) |
Domain d2j28v1: 2j28 V:1-94 [137969] Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28c2, d2j28d1, d2j28e1, d2j28f1, d2j28g1, d2j28g2, d2j28h1, d2j28h2, d2j28i1, d2j28i2, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28p1, d2j28q1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28w1, d2j28x1, d2j28y1, d2j28z1 automatically matched to d1b75a_ protein/RNA complex; complexed with mg |
PDB Entry: 2j28 (more details), 8 Å
SCOPe Domain Sequences for d2j28v1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j28v1 b.53.1.1 (V:1-94) Ribosomal protein L25 {Escherichia coli [TaxId: 562]} mftinaevrkeqgkgasrrlraankfpaiiyggkeaplaieldhdkvmnmqakaefysev ltivvdgkeikvkaqdvqrhpykpklqhidfvra
Timeline for d2j28v1:
View in 3D Domains from other chains: (mouse over for more information) d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28c2, d2j28d1, d2j28e1, d2j28f1, d2j28g1, d2j28g2, d2j28h1, d2j28h2, d2j28i1, d2j28i2, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28p1, d2j28q1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28w1, d2j28x1, d2j28y1, d2j28z1 |