Lineage for d2j28c2 (2j28 C:61-124)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789812Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2789822Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
    Uniprot P60422 3-124
  8. 2789847Domain d2j28c2: 2j28 C:61-124 [145623]
    Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28d1, d2j28e1, d2j28f1, d2j28g1, d2j28g2, d2j28h1, d2j28h2, d2j28i1, d2j28i2, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28p1, d2j28q1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28v1, d2j28w1, d2j28x1, d2j28y1, d2j28z1
    automatically matched to 2AW4 C:61-124
    protein/RNA complex; complexed with mg

    missing some secondary structures that made up less than one-third of the common domain

Details for d2j28c2

PDB Entry: 2j28 (more details), 8 Å

PDB Description: model of e. coli srp bound to 70s rncs
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2j28c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j28c2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

SCOPe Domain Coordinates for d2j28c2:

Click to download the PDB-style file with coordinates for d2j28c2.
(The format of our PDB-style files is described here.)

Timeline for d2j28c2: