Class b: All beta proteins [48724] (165 folds) |
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) |
Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
Protein Ribosomal protein L25 [50717] (1 species) |
Species Escherichia coli [TaxId:562] [50718] (12 PDB entries) |
Domain d2j28v1: 2j28 V:1-94 [137969] Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28l1, d2j28m1, d2j28p1, d2j28r1, d2j28u1, d2j28x1, d2j28z1 automatically matched to d1b75a_ complexed with mg |
PDB Entry: 2j28 (more details), 8 Å
SCOP Domain Sequences for d2j28v1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j28v1 b.53.1.1 (V:1-94) Ribosomal protein L25 {Escherichia coli [TaxId: 562]} mftinaevrkeqgkgasrrlraankfpaiiyggkeaplaieldhdkvmnmqakaefysev ltivvdgkeikvkaqdvqrhpykpklqhidfvra
Timeline for d2j28v1: