SCOPe 2.08: Domain d2j28g1: 2j28 G:1-81

Lineage for d2j28g1 (2j28 G:1-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
   Uniprot P02390 1-81! Uniprot P02390 82-176

8. Domain d2j28g1: 2j28 G:1-81 [145627]
   Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28c2, d2j28d1, d2j28e1, d2j28f1, d2j28h1, d2j28h2, d2j28i1, d2j28i2, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28p1, d2j28q1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28v1, d2j28w1, d2j28x1, d2j28y1, d2j28z1
   automatically matched to 2AW4 G:1-81
   protein/RNA complex; complexed with mg

Details for d2j28g1

PDB Entry: 2j28, 8 Å

PDB Description: model of e. coli srp bound to 70s rncs

PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2j28g1:

Sequence; same for both SEQRES and ATOM records:

>d2j28g1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
srvakapvvvpagvdvkingqvitikgkngeltrtlndavevkhadntltfgprdgyadg
waqagtarallnsmvigvteg

Timeline for d2j28g1:

• d2j28g1 first appeared in SCOP 1.75
  
• d2j28g1 appears in SCOPe 2.07