![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.268: PTPA-like [140983] (1 superfamily) multihelical |
![]() | Superfamily a.268.1: PTPA-like [140984] (1 family) ![]() automatically mapped to Pfam PF03095 |
![]() | Family a.268.1.1: PTPA-like [140985] (2 proteins) Pfam PF03095 |
![]() | Protein automated matches [190724] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187883] (3 PDB entries) |
![]() | Domain d2ixpb_: 2ixp B: [137782] Other proteins in same PDB: d2ixpa1 automated match to d2ixoa1 complexed with cl, so4 |
PDB Entry: 2ixp (more details), 2.8 Å
SCOPe Domain Sequences for d2ixpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ixpb_ a.268.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sldrvdwphatfstpvkrifdtqttldfqsslaihrikyhlhkyttlishcsdpdphata ssiamvnglmgvldklahlidetpplpgprrygnlacrewhhklderlpqwlqemlpsey hevvpelqyylgnsfgsstrldygtghelsfmatvaaldmlgmfphmrgadvfllfnkyy timrrliltytlepagshgvwglddhfhlvyilgssqwqlldaqaplqpreildkslvre ykdtnfycqginfinevkmgpfeehspilydiavtvprwskvckgllkmysvevlkkfpv vqhfwfgtgffpwvni
Timeline for d2ixpb_: