Lineage for d2ixpa1 (2ixp A:2-317)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016427Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 2016428Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
    automatically mapped to Pfam PF03095
  5. 2016429Family a.268.1.1: PTPA-like [140985] (2 protein domains)
    Pfam PF03095
  6. 2016430Protein Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA [140986] (2 species)
  7. 2016431Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140988] (3 PDB entries)
    Uniprot Q12461 2-317! Uniprot Q12461 3-299
  8. 2016434Domain d2ixpa1: 2ixp A:2-317 [137781]
    Other proteins in same PDB: d2ixpb_, d2ixpc_, d2ixpd_
    complexed with cl, so4

Details for d2ixpa1

PDB Entry: 2ixp (more details), 2.8 Å

PDB Description: crystal structure of the pp2a phosphatase activator ypa1 ptpa1 in complex with model substrate
PDB Compounds: (A:) serine/threonine-protein phosphatase 2a activator 1

SCOPe Domain Sequences for d2ixpa1:

Sequence, based on SEQRES records: (download)

>d2ixpa1 a.268.1.1 (A:2-317) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sldrvdwphatfstpvkrifdtqttldfqsslaihrikyhlhkyttlishcsdpdphata
ssiamvnglmgvldklahlidetpplpgprrygnlacrewhhklderlpqwlqemlpsey
hevvpelqyylgnsfgsstrldygtghelsfmatvaaldmlgmfphmrgadvfllfnkyy
timrrliltytlepagshgvwglddhfhlvyilgssqwqlldaqaplqpreildkslvre
ykdtnfycqginfinevkmgpfeehspilydiavtvprwskvckgllkmysvevlkkfpv
vqhfwfgtgffpwvni

Sequence, based on observed residues (ATOM records): (download)

>d2ixpa1 a.268.1.1 (A:2-317) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sldrvdwphatfstpvkrifdtqttldfqsslaihrikyhlhkyttlishcsdpdphata
ssiamvnglmgvldklahlidetpplgnlacrewhhklderlpqwlqemlpseyhevvpe
lqyylgnsfgsstrldygtghelsfmatvaaldmlgmfphmrgadvfllfnkyytimrrl
iltytlepagshgvwglddhfhlvyilgssqwqlldaqaplqpreildkslvreykdtnf
ycqginfinevkmgpfeehspilydiavtvprwskvckgllkmysvevlkkfpvvqhfwf
gtgffpwvni

SCOPe Domain Coordinates for d2ixpa1:

Click to download the PDB-style file with coordinates for d2ixpa1.
(The format of our PDB-style files is described here.)

Timeline for d2ixpa1: