SCOPe 2.08: Domain d2ixpc_: 2ixp C:

Lineage for d2ixpc_ (2ixp C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.268: PTPA-like [140983] (1 superfamily)
   multihelical

4. Superfamily a.268.1: PTPA-like [140984] (1 family)
   automatically mapped to Pfam PF03095

5. Family a.268.1.1: PTPA-like [140985] (2 proteins)
   Pfam PF03095

6. Protein automated matches [190724] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187883] (3 PDB entries)

8. Domain d2ixpc_: 2ixp C: [137783]
   Other proteins in same PDB: d2ixpa1
   automated match to d2ixoa1
   complexed with cl, so4

Details for d2ixpc_

PDB Entry: 2ixp, 2.8 Å

PDB Description: crystal structure of the pp2a phosphatase activator ypa1 ptpa1 in complex with model substrate

PDB Compounds: (C:) serine/threonine-protein phosphatase 2a activator 1

SCOPe Domain Sequences for d2ixpc_:

Sequence; same for both SEQRES and ATOM records:

>d2ixpc_ a.268.1.1 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sldrvdwphatfstpvkrifdtqttldfqsslaihrikyhlhkyttlishcsdpdphata
ssiamvnglmgvldklahlidetpplpgprrygnlacrewhhklderlpqwlqemlpsey
hevvpelqyylgnsfgsstrldygtghelsfmatvaaldmlgmfphmrgadvfllfnkyy
timrrliltytlepagshgvwglddhfhlvyilgssqwqlldaqaplqpreildkslvre
ykdtnfycqginfinevkmgpfeehspilydiavtvprwskvckgllkmysvevlkkfpv
vqhfwfgtgffpwvni

Timeline for d2ixpc_:

• d2ixpc_ first appeared in SCOP 1.73, called d2ixpc1
  
• d2ixpc_ appears in SCOPe 2.07