Lineage for d2isic_ (2isi C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548551Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2548607Protein automated matches [190454] (2 species)
    not a true protein
  7. 2548608Species Human (Homo sapiens) [TaxId:9606] [187368] (6 PDB entries)
  8. 2548619Domain d2isic_: 2isi C: [137605]
    automated match to d2o3ha_
    complexed with mg, po4

Details for d2isic_

PDB Entry: 2isi (more details), 2.76 Å

PDB Description: Crystal structure of Ape1 from Homo sapiens in a new crystal form complexed with a ligand
PDB Compounds: (C:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d2isic_:

Sequence, based on SEQRES records: (download)

>d2isic_ d.151.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

Sequence, based on observed residues (ATOM records): (download)

>d2isic_ d.151.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapegysgvgllsrqcplkvsygigdeehdqegrvivaefdsf
vlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpkg
nkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldyf
llshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d2isic_:

Click to download the PDB-style file with coordinates for d2isic_.
(The format of our PDB-style files is described here.)

Timeline for d2isic_: