Lineage for d2isib_ (2isi B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. Protein automated matches [190454] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187368] (6 PDB entries)
  8. Domain d2isib_: 2isi B: [137604]
    automated match to d2o3ha_
    complexed with mg, po4

Details for d2isib_

PDB Entry: 2isi (more details), 2.76 Å

PDB Description: Crystal structure of Ape1 from Homo sapiens in a new crystal form complexed with a ligand
PDB Compounds: (B:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d2isib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2isib_ d.151.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d2isib_ are not available.

Timeline for d2isib_:

Domains from other chains:
(mouse over for more information)
d2isia_, d2isic_