PDB entry 2isi

View 2isi on RCSB PDB site
Description: Crystal structure of Ape1 from Homo sapiens in a new crystal form complexed with a ligand
Class: lyase
Keywords: ape1, crystal structure, magnesium, LYASE
Deposited on 2006-10-17, released 2006-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.228
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-(apurinic or apyrimidinic site) lyase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2isia_
  • Chain 'B':
    Compound: DNA-(apurinic or apyrimidinic site) lyase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2isib_
  • Chain 'C':
    Compound: DNA-(apurinic or apyrimidinic site) lyase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2isic_
  • Heterogens: PO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2isiA (A:)
    pkrgkkgavaedgdelrtepeakksktaakkndkeaagegpalyedppdqktspsgkpat
    lkicswnvdglrawikkkgldwvkeeapdilclqetkcsenklpaelqelpglshqywsa
    psdkegysgvgllsrqcplkvsygigdeehdqegrvivaefdsfvlvtayvpnagrglvr
    leyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpkgnkknagftpqerqgfg
    ellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldyfllshsllpalcdskir
    skalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isiA (A:)
    alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
    klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
    dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
    pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
    dyfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2isiB (B:)
    pkrgkkgavaedgdelrtepeakksktaakkndkeaagegpalyedppdqktspsgkpat
    lkicswnvdglrawikkkgldwvkeeapdilclqetkcsenklpaelqelpglshqywsa
    psdkegysgvgllsrqcplkvsygigdeehdqegrvivaefdsfvlvtayvpnagrglvr
    leyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpkgnkknagftpqerqgfg
    ellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldyfllshsllpalcdskir
    skalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isiB (B:)
    alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
    klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
    dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
    pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
    dyfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2isiC (C:)
    pkrgkkgavaedgdelrtepeakksktaakkndkeaagegpalyedppdqktspsgkpat
    lkicswnvdglrawikkkgldwvkeeapdilclqetkcsenklpaelqelpglshqywsa
    psdkegysgvgllsrqcplkvsygigdeehdqegrvivaefdsfvlvtayvpnagrglvr
    leyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpkgnkknagftpqerqgfg
    ellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldyfllshsllpalcdskir
    skalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isiC (C:)
    alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
    klpaelqelpglshqywsapegysgvgllsrqcplkvsygigdeehdqegrvivaefdsf
    vlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpkg
    nkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldyf
    llshsllpalcdskirskalgsdhcpitlylal