Lineage for d2isic1 (2isi C:43-318)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735706Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 735707Superfamily d.151.1: DNase I-like [56219] (3 families) (S)
  5. 735708Family d.151.1.1: DNase I-like [56220] (6 proteins)
  6. 735729Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 735730Species Human (Homo sapiens) [TaxId:9606] [56224] (7 PDB entries)
  8. 735741Domain d2isic1: 2isi C:43-318 [137605]
    automatically matched to d1e9na_
    complexed with mg, po4

Details for d2isic1

PDB Entry: 2isi (more details), 2.76 Å

PDB Description: Crystal structure of Ape1 from Homo sapiens in a new crystal form complexed with a ligand
PDB Compounds: (C:) DNA-(apurinic or apyrimidinic site) lyase

SCOP Domain Sequences for d2isic1:

Sequence, based on SEQRES records: (download)

>d2isic1 d.151.1.1 (C:43-318) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

Sequence, based on observed residues (ATOM records): (download)

>d2isic1 d.151.1.1 (C:43-318) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapegysgvgllsrqcplkvsygigdeehdqegrvivaefdsf
vlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpkg
nkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldyf
llshsllpalcdskirskalgsdhcpitlylal

SCOP Domain Coordinates for d2isic1:

Click to download the PDB-style file with coordinates for d2isic1.
(The format of our PDB-style files is described here.)

Timeline for d2isic1: