![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) ![]() |
![]() | Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
![]() | Protein Aldose reductase (aldehyde reductase) [51436] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [51437] (102 PDB entries) Uniprot P15121 |
![]() | Domain d2isfa_: 2isf A: [137602] automated match to d1az1__ complexed with nap, pac |
PDB Entry: 2isf (more details), 2 Å
SCOPe Domain Sequences for d2isfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2isfa_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} srlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqek lreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgkef fpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpav nqiechpyltqekliqycqskgivvtaysplgspdrpyakpedpslledprikaiaakhn kttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvaall sctshkdypfheef
Timeline for d2isfa_: