SCOP 1.73: Domain d2isfa1: 2isf A:2-315

Lineage for d2isfa1 (2isf A:2-315)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51437] (53 PDB entries)

8. Domain d2isfa1: 2isf A:2-315 [137602]
   automatically matched to d1az1__
   complexed with nap, pac; mutant

Details for d2isfa1

PDB Entry: 2isf, 2 Å

PDB Description: crystal structure of c298a w219y aldose reductase complexed with phenylacetic acid

PDB Compounds: (A:) aldose reductase

SCOP Domain Sequences for d2isfa1:

Sequence; same for both SEQRES and ATOM records:

>d2isfa1 c.1.7.1 (A:2-315) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
srlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqek
lreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgkef
fpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpav
nqiechpyltqekliqycqskgivvtaysplgspdrpyakpedpslledprikaiaakhn
kttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvaall
sctshkdypfheef

Timeline for d2isfa1:

• d2isfa1 is new in SCOP 1.73
  
• d2isfa1 appears in SCOP 1.75
  
• d2isfa1 appears in the current release, SCOPe 2.08, called d2isfa_