Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.8: YeeU-like [143737] (1 family) beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer automatically mapped to Pfam PF06154 |
Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins) Pfam PF06154 |
Protein Hypothetical protein YeeU [143741] (2 species) |
Species Shigella flexneri [TaxId:623] [143743] (1 PDB entry) Uniprot Q83JN9 4-120 |
Domain d2inwa1: 2inw A:4-120 [137533] complexed with po4 |
PDB Entry: 2inw (more details), 1.5 Å
SCOPe Domain Sequences for d2inwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2inwa1 d.110.8.1 (A:4-120) Hypothetical protein YeeU {Shigella flexneri [TaxId: 623]} tlpgttppddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirgrfsdvdayhld qafpllmkqlelmltggelnprhqhtvtlyakgltceadtlgscgyvylavyptpaa
Timeline for d2inwa1: