Lineage for d2inwa1 (2inw A:4-120)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731578Fold d.110: Profilin-like [55769] (9 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 731869Superfamily d.110.8: YeeU-like [143737] (1 family) (S)
    beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer
  5. 731870Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins)
    Pfam PF06154
  6. 731871Protein Hypothetical protein YeeU [143741] (2 species)
  7. 731875Species Shigella flexneri [TaxId:623] [143743] (1 PDB entry)
  8. 731876Domain d2inwa1: 2inw A:4-120 [137533]
    complexed with po4

Details for d2inwa1

PDB Entry: 2inw (more details), 1.5 Å

PDB Description: Crystal structure of Q83JN9 from Shigella flexneri at high resolution. Northeast Structural Genomics Consortium target SfR137.
PDB Compounds: (A:) Putative structural protein

SCOP Domain Sequences for d2inwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2inwa1 d.110.8.1 (A:4-120) Hypothetical protein YeeU {Shigella flexneri [TaxId: 623]}
tlpgttppddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirgrfsdvdayhld
qafpllmkqlelmltggelnprhqhtvtlyakgltceadtlgscgyvylavyptpaa

SCOP Domain Coordinates for d2inwa1:

Click to download the PDB-style file with coordinates for d2inwa1.
(The format of our PDB-style files is described here.)

Timeline for d2inwa1: