PDB entry 2inw

View 2inw on RCSB PDB site
Description: Crystal structure of Q83JN9 from Shigella flexneri at high resolution. Northeast Structural Genomics Consortium target SfR137.
Class: structural genomics, unknown function
Keywords: Q83JN9 X-Ray NESG SfR137, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-10-09, released 2006-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.225
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative structural protein
    Species: Shigella flexneri [TaxId:623]
    Gene: yeeU, SF2998, S_3203
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83JN9
      • modified residue (69)
      • modified residue (75)
    Domains in SCOPe 2.08: d2inwa1
  • Chain 'B':
    Compound: Putative structural protein
    Species: Shigella flexneri [TaxId:623]
    Gene: yeeU, SF2998, S_3203
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83JN9
      • modified residue (69)
      • modified residue (75)
    Domains in SCOPe 2.08: d2inwb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2inwA (A:)
    msdtlpgttppddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirgrfsdvday
    hldqafpllmkqlelmltggelnprhqhtvtlyakgltceadtlgscgyvylavyptpaa
    pattvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2inwA (A:)
    tlpgttppddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirgrfsdvdayhld
    qafpllmkqlelmltggelnprhqhtvtlyakgltceadtlgscgyvylavyptpaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2inwB (B:)
    msdtlpgttppddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirgrfsdvday
    hldqafpllmkqlelmltggelnprhqhtvtlyakgltceadtlgscgyvylavyptpaa
    pattvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2inwB (B:)
    tlpgttppddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirgrfsdvdayhld
    qafpllmkqlelmltggelnprhqhtvtlyakgltceadtlgscgyvylavyptpa