Lineage for d2imwp2 (2imw P:2-240)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884843Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 884844Protein DinB homolog (DBH) [100889] (3 species)
  7. 884850Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (50 PDB entries)
  8. 884865Domain d2imwp2: 2imw P:2-240 [137520]
    Other proteins in same PDB: d2imwp1
    automatically matched to d1jx4a2
    complexed with ca, dad, edo

Details for d2imwp2

PDB Entry: 2imw (more details), 2.05 Å

PDB Description: mechanism of template-independent nucleotide incorporation catalyzed by a template-dependent dna polymerase
PDB Compounds: (P:) DNA polymerase IV

SCOP Domain Sequences for d2imwp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imwp2 e.8.1.7 (P:2-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
ivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagipi
veakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyrea
ynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldia
dvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOP Domain Coordinates for d2imwp2:

Click to download the PDB-style file with coordinates for d2imwp2.
(The format of our PDB-style files is described here.)

Timeline for d2imwp2: