Lineage for d1jx4a2 (1jx4 A:1-240)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884843Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 884844Protein DinB homolog (DBH) [100889] (3 species)
  7. 884850Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (50 PDB entries)
  8. 884851Domain d1jx4a2: 1jx4 A:1-240 [90379]
    Other proteins in same PDB: d1jx4a1
    complexed with adi, ca, mg

Details for d1jx4a2

PDB Entry: 1jx4 (more details), 1.7 Å

PDB Description: Crystal Structure of a Y-family DNA Polymerase in a Ternary Complex with DNA Substrates and an Incoming Nucleotide
PDB Compounds: (A:) DNA polymerase IV (family Y)

SCOP Domain Sequences for d1jx4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jx4a2 e.8.1.7 (A:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOP Domain Coordinates for d1jx4a2:

Click to download the PDB-style file with coordinates for d1jx4a2.
(The format of our PDB-style files is described here.)

Timeline for d1jx4a2:

884851
d1jx4a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1jx4a1