SCOPe 2.08: Domain d2im3a_: 2im3 A:

Lineage for d2im3a_ (2im3 A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein Viral RNA polymerase [56695] (17 species)

7. Species Human poliovirus 1 [TaxId:12081] [256393] (8 PDB entries)

8. Domain d2im3a_: 2im3 A: [137505]
   automated match to d1ra6a_
   complexed with acy, mn, na, utp
   missing some secondary structures that made up less than one-third of the common domain

Details for d2im3a_

PDB Entry: 2im3, 2.6 Å

PDB Description: crystal structure of poliovirus polymerase complexed with utp and mn2+

PDB Compounds: (A:) Poliovirus polymerase

SCOPe Domain Sequences for d2im3a_:

Sequence; same for both SEQRES and ATOM records:

>d2im3a_ e.8.1.4 (A:) Viral RNA polymerase {Human poliovirus 1 [TaxId: 12081]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlydrwldsf

Timeline for d2im3a_:

• d2im3a_ first appeared in SCOP 1.73, called d2im3a1
  
• d2im3a_ appears in SCOPe 2.07