SCOP 1.73: Domain d2im3a1: 2im3 A:1-461

Lineage for d2im3a1 (2im3 A:1-461)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins)

6. Protein Viral RNA polymerase [56695] (9 species)

7. Species Poliovirus type 1, strain Mahoney [TaxId:12080] [56696] (12 PDB entries)

8. Domain d2im3a1: 2im3 A:1-461 [137505]
   automatically matched to d1ra6a_
   complexed with acy, cas, mn, na, utp; mutant

Details for d2im3a1

PDB Entry: 2im3, 2.6 Å

PDB Description: crystal structure of poliovirus polymerase complexed with utp and mn2+

PDB Compounds: (A:) Poliovirus polymerase

SCOP Domain Sequences for d2im3a1:

Sequence; same for both SEQRES and ATOM records:

>d2im3a1 e.8.1.4 (A:1-461) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlydrwldsf

Timeline for d2im3a1:

• d2im3a1 is new in SCOP 1.73
  
• d2im3a1 appears in SCOP 1.75
  
• d2im3a1 appears in the current release, SCOPe 2.08, called d2im3a_