|  | Class a: All alpha proteins [46456] (284 folds) | 
|  | Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf | 
|  | Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)  this domain interrupts the G-protein common fold | 
|  | Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) | 
|  | Protein Transducin (alpha subunit), insertion domain [47897] (4 species) | 
|  | Species Human (Homo sapiens) [TaxId:9606] [158559] (7 PDB entries) | 
|  | Domain d2ik8a1: 2ik8 A:61-181 [137484] Other proteins in same PDB: d2ik8a2, d2ik8b1, d2ik8c2, d2ik8d_ automatically matched to d1kjya1 complexed with alf, gdp, mg, so4 | 
PDB Entry: 2ik8 (more details), 2.71 Å
SCOPe Domain Sequences for d2ik8a1:
Sequence, based on SEQRES records: (download)
>d2ik8a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t
>d2ik8a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlamtaelagvi
krlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt
Timeline for d2ik8a1:
|  View in 3D Domains from other chains: (mouse over for more information) d2ik8b1, d2ik8c1, d2ik8c2, d2ik8d_ |