Lineage for d2ik8a2 (2ik8 A:32-60,A:182-348)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363685Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1363710Species Human (Homo sapiens) [TaxId:9606] [159560] (7 PDB entries)
  8. 1363721Domain d2ik8a2: 2ik8 A:32-60,A:182-348 [137485]
    Other proteins in same PDB: d2ik8a1, d2ik8b1, d2ik8c1, d2ik8d_
    automatically matched to d1kjya2
    complexed with alf, gdp, mg, so4

Details for d2ik8a2

PDB Entry: 2ik8 (more details), 2.71 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS16 and activated Gi alpha 1
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2ik8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ik8a2 c.37.1.8 (A:32-60,A:182-348) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdviiknnl

SCOPe Domain Coordinates for d2ik8a2:

Click to download the PDB-style file with coordinates for d2ik8a2.
(The format of our PDB-style files is described here.)

Timeline for d2ik8a2: