Lineage for d2ik8a1 (2ik8 A:61-181)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643730Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 643731Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 643732Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 643733Protein Transducin (alpha subunit), insertion domain [47897] (3 species)
  7. 643760Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (24 PDB entries)
  8. 643783Domain d2ik8a1: 2ik8 A:61-181 [137484]
    Other proteins in same PDB: d2ik8a2, d2ik8c2
    automatically matched to d1kjya1
    complexed with alf, gdp, mg, so4

Details for d2ik8a1

PDB Entry: 2ik8 (more details), 2.71 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS16 and activated Gi alpha 1
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOP Domain Sequences for d2ik8a1:

Sequence, based on SEQRES records: (download)

>d2ik8a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Sequence, based on observed residues (ATOM records): (download)

>d2ik8a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlamtaelagvi
krlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt

SCOP Domain Coordinates for d2ik8a1:

Click to download the PDB-style file with coordinates for d2ik8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ik8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ik8a2