![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Transducin (alpha subunit) [52623] (3 species) common fold is interrupted with an all-alpha domain |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (26 PDB entries) |
![]() | Domain d2ik8c2: 2ik8 C:33-60,C:182-348 [137487] Other proteins in same PDB: d2ik8a1, d2ik8c1 automatically matched to d1kjya2 complexed with alf, gdp, mg, so4 |
PDB Entry: 2ik8 (more details), 2.71 Å
SCOP Domain Sequences for d2ik8c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ik8c2 c.37.1.8 (C:33-60,C:182-348) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} evkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwi hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv qfvfdavtdviiknnl
Timeline for d2ik8c2: