Class a: All alpha proteins [46456] (290 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [158559] (9 PDB entries) |
Domain d2ik8a1: 2ik8 A:61-181 [137484] Other proteins in same PDB: d2ik8a2, d2ik8b1, d2ik8c2, d2ik8d_ automatically matched to d1kjya1 complexed with alf, gdp, mg, so4 |
PDB Entry: 2ik8 (more details), 2.71 Å
SCOPe Domain Sequences for d2ik8a1:
Sequence, based on SEQRES records: (download)
>d2ik8a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk t
>d2ik8a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlamtaelagvi krlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt
Timeline for d2ik8a1:
View in 3D Domains from other chains: (mouse over for more information) d2ik8b1, d2ik8c1, d2ik8c2, d2ik8d_ |