Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Laccase, middle domain [418906] (5 species) |
Species Fungus (Melanocarpus albomyces) [TaxId:204285] [419308] (9 PDB entries) |
Domain d2ih8b2: 2ih8 B:163-343 [137411] Other proteins in same PDB: d2ih8a1, d2ih8a3, d2ih8b1, d2ih8b3 automated match to d1gw0a2 complexed with cl, cu, nag, oxy, so4 |
PDB Entry: 2ih8 (more details), 2 Å
SCOPe Domain Sequences for d2ih8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ih8b2 b.6.1.3 (B:163-343) Laccase, middle domain {Fungus (Melanocarpus albomyces) [TaxId: 204285]} ydidlgvfpitdyyyraaddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpg krhrlrilntstenhfqvslvnhtmtviaadmvpvnamtvdslflavgqrydvvidasra pdnywfnvtfggqaacggslnphpaaifhyagapgglptdegtppvdhqcldtldvrpvv p
Timeline for d2ih8b2: