PDB entry 2ih8

View 2ih8 on RCSB PDB site
Description: A low-dose crystal structure of a recombinant Melanocarpus albomyces laccase
Class: oxidoreductase
Keywords: laccase, multicopper oxidase, redox-enzyme, OXIDOREDUCTASE
Deposited on 2006-09-26, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Laccase-1
    Species: Melanocarpus albomyces [TaxId:204285]
    Gene: LAC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ih8a1, d2ih8a2, d2ih8a3
  • Chain 'B':
    Compound: Laccase-1
    Species: Melanocarpus albomyces [TaxId:204285]
    Gene: LAC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ih8b1, d2ih8b2, d2ih8b3
  • Heterogens: NAG, NDG, CU, CL, SO4, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ih8A (A:)
    eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
    ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
    gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslpydidlgvfpitdyyyraa
    ddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpgkrhrlrilntstenhfqv
    slvnhtmtviaadmvpvnamtvdslflavgqrydvvidasrapdnywfnvtfggqaacgg
    slnphpaaifhyagapgglptdegtppvdhqcldtldvrpvvprsvpvnsfvkrpdntlp
    valdltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsdnivqvdavdqwtywlie
    ndpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpavdlarlngdnpprrdttm
    lpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpadlrqrisqededdfnrvc
    dewraywptnpypkidsgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ih8B (B:)
    eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
    ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
    gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslpydidlgvfpitdyyyraa
    ddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpgkrhrlrilntstenhfqv
    slvnhtmtviaadmvpvnamtvdslflavgqrydvvidasrapdnywfnvtfggqaacgg
    slnphpaaifhyagapgglptdegtppvdhqcldtldvrpvvprsvpvnsfvkrpdntlp
    valdltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsdnivqvdavdqwtywlie
    ndpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpavdlarlngdnpprrdttm
    lpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpadlrqrisqededdfnrvc
    dewraywptnpypkidsgl