SCOPe 2.08: Domain d2ig9a1: 2ig9 A:4-147

Lineage for d2ig9a1 (2ig9 A:4-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)

7. Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries)

8. Domain d2ig9a1: 2ig9 A:4-147 [137352]
   automated match to d1q0oa1
   complexed with ca, cl, fe2, gol

Details for d2ig9a1

PDB Entry: 2ig9, 1.9 Å

PDB Description: Structure of a full-length Homoprotocatechuate 2,3-Dioxygenase from B. fuscum in a new spacegroup.

PDB Compounds: (A:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d2ig9a1:

Sequence; same for both SEQRES and ATOM records:

>d2ig9a1 d.32.1.3 (A:4-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
fpyefffetthverlhmrydlysa

Timeline for d2ig9a1:

• d2ig9a1 first appeared in SCOP 1.73
  
• d2ig9a1 appears in SCOPe 2.07