Lineage for d2ig9c2 (2ig9 C:148-362)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries)
  8. Domain d2ig9c2: 2ig9 C:148-362 [137357]
    automated match to d1q0oa2
    complexed with ca, cl, fe2, gol

Details for d2ig9c2

PDB Entry: 2ig9 (more details), 1.9 Å

PDB Description: Structure of a full-length Homoprotocatechuate 2,3-Dioxygenase from B. fuscum in a new spacegroup.
PDB Compounds: (C:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d2ig9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ig9c2 d.32.1.3 (C:148-362) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeiiertdd
selevtigadgfsftragdedgsyhgqaskgfklg

SCOPe Domain Coordinates for d2ig9c2 are not available.

Timeline for d2ig9c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ig9c1
View in 3D
Domains from other chains:
(mouse over for more information)
d2ig9a1, d2ig9a2, d2ig9b1, d2ig9b2, d2ig9d1, d2ig9d2