Lineage for d2icwg_ (2icw G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349410Fold a.202: Superantigen MAM [101343] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349411Superfamily a.202.1: Superantigen MAM [101344] (1 family) (S)
    automatically mapped to Pfam PF09245
  5. 2349412Family a.202.1.1: Superantigen MAM [101345] (2 proteins)
  6. 2349413Protein Superantigen MAM [101346] (1 species)
  7. 2349414Species Mycoplasma arthritidis [TaxId:2111] [101347] (3 PDB entries)
  8. 2349415Domain d2icwg_: 2icw G: [137251]
    Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2, d2icwj1, d2icwj2, d2icwl2, d2icwl3
    automated match to d1r5id_

Details for d2icwg_

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
PDB Compounds: (G:) Mycoplasma arthritidis mitogen

SCOPe Domain Sequences for d2icwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icwg_ a.202.1.1 (G:) Superantigen MAM {Mycoplasma arthritidis [TaxId: 2111]}
mklrvenpkkaqkhfvqnlnnvvftnkelediynlsnkeetkevlklfklkvnqfyrhaf
givndynglleykeifnmmflklsvvfdtqrkeannveqikrniaildeimakadndlsy
fisqnknfqelwdkavkltkemkiklkgqkldlrdgevainkvrelfgsdknvkelwwfr
sllvkgvylikryyegdielkttsdfakavfed

SCOPe Domain Coordinates for d2icwg_:

Click to download the PDB-style file with coordinates for d2icwg_.
(The format of our PDB-style files is described here.)

Timeline for d2icwg_: