![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries) |
![]() | Domain d2icwd2: 2icw D:13-81 [137248] Other proteins in same PDB: d2icwa1, d2icwb1, d2icwb2, d2icwd1, d2icwe1, d2icwe2, d2icwg_, d2icwh_, d2icwj1, d2icwj2, d2icwl2, d2icwl3 automatically matched to d1k2da2 |
PDB Entry: 2icw (more details), 2.41 Å
SCOPe Domain Sequences for d2icwd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icwd2 d.19.1.1 (D:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]} ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei mtkrsnytp
Timeline for d2icwd2: