![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
![]() | Domain d2icwb1: 2icw B:93-190 [137245] Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb2, d2icwd1, d2icwd2, d2icwe2, d2icwg_, d2icwh_, d2icwj1, d2icwj2, d2icwl2, d2icwl3 automatically matched to d1d5xb1 |
PDB Entry: 2icw (more details), 2.41 Å
SCOPe Domain Sequences for d2icwb1:
Sequence, based on SEQRES records: (download)
>d2icwb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
>d2icwb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsktnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtl vmletvprsgevytcqvehpsvtspltvewra
Timeline for d2icwb1: