SCOP 1.75: Domain d2hxva2: 2hxv A:1-147

Lineage for d2hxva2 (2hxv A:1-147)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (5 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
   strand 5 is parallel to strand 4

6. Protein Riboflavin biosynthesis protein RibD [142837] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [142839] (1 PDB entry)
   Uniprot Q9X2E8 1-147

8. Domain d2hxva2: 2hxv A:1-147 [136860]
   Other proteins in same PDB: d2hxva1
   complexed with cl, gol, ndp, zn

Details for d2hxva2

PDB Entry: 2hxv, 1.8 Å

PDB Description: crystal structure of a diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase (tm1828) from thermotoga maritima at 1.80 a resolution

PDB Compounds: (A:) Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase

SCOP Domain Sequences for d2hxva2:

Sequence; same for both SEQRES and ATOM records:

>d2hxva2 c.97.1.2 (A:1-147) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]}
myetfmkraielakkglgrvnpnppvgavvvkdgriiaegfhpyfggphaermaiesark
kgedlrgatlivtlepcdhhgktppctdliiesgiktvvigtrdpnpvsgngvekfrnhg
ieviegvleeevkklceffityvtkkr

Timeline for d2hxva2:

• d2hxva2 first appeared in SCOP 1.73
  
• d2hxva2 appears in SCOPe 2.01
  
• d2hxva2 appears in the current release, SCOPe 2.08