PDB entry 2hxv

View 2hxv on RCSB PDB site
Description: Crystal structure of Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase (TM1828) from Thermotoga maritima at 1.80 A resolution
Class: hydrolase, oxidoreductase
Keywords: TM1828, Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2006-08-04, released 2006-08-15
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase
    Species: Thermotoga maritima
    Gene: TM1828
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X2E8 (12-End)
      • leader sequence (8-11)
      • modified residue (12)
      • modified residue (17)
      • modified residue (64)
      • modified residue (194)
      • modified residue (353)
    Domains in SCOP 1.75: d2hxva1, d2hxva2
  • Heterogens: ZN, CL, NDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hxvA (A:)
    mgsdkihhhhhhmyetfmkraielakkglgrvnpnppvgavvvkdgriiaegfhpyfggp
    haermaiesarkkgedlrgatlivtlepcdhhgktppctdliiesgiktvvigtrdpnpv
    sgngvekfrnhgieviegvleeevkklceffityvtkkrpfvalkyastldgkiadhrgd
    skwitdklrfkvhemrniysavlvgagtvlkdnpqltcrlkegrnpvrvildrkgvlsgk
    vfrvfeenarvivfteseeaeypphvekalsdcsvesilrnlyerdidsvlveggskvfs
    efldhadvvfgfystkifgkgldvfsgylsdvsvppkfkvvnvefsdseflvemrpcsre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hxvA (A:)
    hhhhmyetfmkraielakkglgrvnpnppvgavvvkdgriiaegfhpyfggphaermaie
    sarkkgedlrgatlivtlepcdhhgktppctdliiesgiktvvigtrdpnpvsgngvekf
    rnhgieviegvleeevkklceffityvtkkrpfvalkyastldgkiadhrgdskwitdkl
    rfkvhemrniysavlvgagtvlkdnpqltcrlkegrnpvrvildrkgvlsgkvfrvfeen
    arvivfteseeaeypphvekalsdcsvesilrnlyerdidsvlveggskvfsefldhadv
    vfgfystkifgkgldvfsgylsdvsvppkfkvvnvefsdseflvemrpc