Lineage for d2hxva2 (2hxv A:1-147)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918566Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 2918623Protein Riboflavin biosynthesis protein RibD [142837] (2 species)
  7. 2918641Species Thermotoga maritima [TaxId:2336] [142839] (1 PDB entry)
    Uniprot Q9X2E8 1-147
  8. 2918642Domain d2hxva2: 2hxv A:1-147 [136860]
    Other proteins in same PDB: d2hxva1, d2hxva3
    complexed with cl, gol, ndp, zn

Details for d2hxva2

PDB Entry: 2hxv (more details), 1.8 Å

PDB Description: crystal structure of a diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase (tm1828) from thermotoga maritima at 1.80 a resolution
PDB Compounds: (A:) Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase

SCOPe Domain Sequences for d2hxva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxva2 c.97.1.2 (A:1-147) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]}
myetfmkraielakkglgrvnpnppvgavvvkdgriiaegfhpyfggphaermaiesark
kgedlrgatlivtlepcdhhgktppctdliiesgiktvvigtrdpnpvsgngvekfrnhg
ieviegvleeevkklceffityvtkkr

SCOPe Domain Coordinates for d2hxva2:

Click to download the PDB-style file with coordinates for d2hxva2.
(The format of our PDB-style files is described here.)

Timeline for d2hxva2: