![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
![]() | Protein Riboflavin biosynthesis protein RibD [142837] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [142839] (1 PDB entry) Uniprot Q9X2E8 1-147 |
![]() | Domain d2hxva2: 2hxv A:1-147 [136860] Other proteins in same PDB: d2hxva1 complexed with cl, gol, ndp, zn |
PDB Entry: 2hxv (more details), 1.8 Å
SCOPe Domain Sequences for d2hxva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxva2 c.97.1.2 (A:1-147) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]} myetfmkraielakkglgrvnpnppvgavvvkdgriiaegfhpyfggphaermaiesark kgedlrgatlivtlepcdhhgktppctdliiesgiktvvigtrdpnpvsgngvekfrnhg ieviegvleeevkklceffityvtkkr
Timeline for d2hxva2: