Lineage for d2hxha2 (2hxh A:246-439)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959167Protein Tubulin alpha-subunit [55311] (3 species)
  7. 2959177Species Pig (Sus scrofa) [TaxId:9823] [55312] (3 PDB entries)
  8. 2959180Domain d2hxha2: 2hxh A:246-439 [136850]
    Other proteins in same PDB: d2hxha1, d2hxhb1, d2hxhb2
    automatically matched to d1tuba2
    complexed with adp, gdp, gtp, mg, ta1

Details for d2hxha2

PDB Entry: 2hxh (more details), 11 Å

PDB Description: kif1a head-microtubule complex structure in adp-form
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d2hxha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxha2 d.79.2.1 (A:246-439) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprahfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d2hxha2:

Click to download the PDB-style file with coordinates for d2hxha2.
(The format of our PDB-style files is described here.)

Timeline for d2hxha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hxha1