Lineage for d2hxhb2 (2hxh B:247-437)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525500Protein Tubulin beta-subunit [55313] (2 species)
  7. 2525512Species Pig (Sus scrofa) [TaxId:9823] [55314] (8 PDB entries)
  8. 2525525Domain d2hxhb2: 2hxh B:247-437 [136852]
    Other proteins in same PDB: d2hxha1, d2hxha2, d2hxhb1
    automatically matched to d1sa0b2
    complexed with adp, gdp, gtp, mg, ta1

Details for d2hxhb2

PDB Entry: 2hxh (more details), 11 Å

PDB Description: KIF1A head-microtubule complex structure in adp-form
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d2hxhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxhb2 d.79.2.1 (B:247-437) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
qlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaacd
prhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkms
atfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqq
yqd

SCOPe Domain Coordinates for d2hxhb2:

Click to download the PDB-style file with coordinates for d2hxhb2.
(The format of our PDB-style files is described here.)

Timeline for d2hxhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hxhb1