Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein Tubulin alpha-subunit [52494] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [52495] (3 PDB entries) |
Domain d2hxha1: 2hxh A:2-245 [136849] Other proteins in same PDB: d2hxha2, d2hxhb1, d2hxhb2 automatically matched to d1tuba1 complexed with adp, gdp, gtp, mg, ta1 |
PDB Entry: 2hxh (more details), 11 Å
SCOPe Domain Sequences for d2hxha1:
Sequence, based on SEQRES records: (download)
>d2hxha1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr irkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitas lrfd
>d2hxha1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} recisihvgqagvqignacwelyclehgiqpdghvpravfvdleptvidevrtgtyrqlf hpeqlitgkedaannyarghytigkeiidlvldrirkladqctglqgfsvfhsfgggtgs gftsllmerlsvdygkksklefsiypapqvstavvepynsiltthttlehsdcafmvdne aiydicrrnldierptytnlnrligqivssitaslrfd
Timeline for d2hxha1: