SCOPe 2.02: Domain d2hvxa_: 2hvx A:

Lineage for d2hvxa_ (2hvx A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Chymase (mast cell protease I) [89343] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89344] (8 PDB entries)

8. Domain d2hvxa_: 2hvx A: [136816]
   automated match to d1pjpa_
   complexed with drx

Details for d2hvxa_

PDB Entry: 2hvx, 2.6 Å

PDB Description: discovery of potent, orally active, nonpeptide inhibitors of human mast cell chymase by using structure-based drug design

PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d2hvxa_:

Sequence; same for both SEQRES and ATOM records:

>d2hvxa_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

Timeline for d2hvxa_:

• d2hvxa_ first appeared in SCOP 1.73, called d2hvxa1
  
• d2hvxa_ appears in SCOPe 2.01
  
• d2hvxa_ appears in SCOPe 2.03
  
• d2hvxa_ appears in the current release, SCOPe 2.08