PDB entry 2hvx

View 2hvx on RCSB PDB site
Description: Discovery of Potent, Orally Active, Nonpeptide Inhibitors of Human Mast Cell Chymase by Using Structure-Based Drug Design
Class: hydrolase
Keywords: serine protease, hydrolase
Deposited on 2006-07-31, released 2007-06-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23946 (0-225)
      • engineered (113)
      • engineered (190)
      • engineered (215)
    Domains in SCOPe 2.02: d2hvxa_
  • Heterogens: DRX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hvxA (A:)
    iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
    teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
    rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
    dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan