Lineage for d2hv8b_ (2hv8 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein automated matches [190047] (37 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186768] (280 PDB entries)
  8. Domain d2hv8b_: 2hv8 B: [136795]
    Other proteins in same PDB: d2hv8d1, d2hv8e_, d2hv8f_
    automated match to d1oiva_
    complexed with 2me, gtp, mes, mg, so4

Details for d2hv8b_

PDB Entry: 2hv8 (more details), 1.86 Å

PDB Description: Crystal structure of GTP-bound Rab11 in complex with FIP3
PDB Compounds: (B:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d2hv8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv8b_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri

SCOPe Domain Coordinates for d2hv8b_ are not available.

Timeline for d2hv8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hv8a_, d2hv8c_, d2hv8d1, d2hv8e_, d2hv8f_