Lineage for d2hv8c_ (2hv8 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868202Domain d2hv8c_: 2hv8 C: [136796]
    Other proteins in same PDB: d2hv8d1, d2hv8e_, d2hv8f_
    automated match to d1oiva_
    complexed with 2me, gtp, mes, mg, so4

Details for d2hv8c_

PDB Entry: 2hv8 (more details), 1.86 Å

PDB Description: crystal structure of gtp-bound rab11 in complex with fip3
PDB Compounds: (C:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d2hv8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv8c_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri

SCOPe Domain Coordinates for d2hv8c_:

Click to download the PDB-style file with coordinates for d2hv8c_.
(The format of our PDB-style files is described here.)

Timeline for d2hv8c_: