SCOPe 2.05: Domain d2huec_: 2hue C:

Lineage for d2huec_ (2hue C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (41 PDB entries)

8. Domain d2huec_: 2hue C: [136776]
   Other proteins in same PDB: d2huea1, d2hueb_
   automated match to d1aoif_
   complexed with gol, so4, zn

Details for d2huec_

PDB Entry: 2hue, 1.7 Å

PDB Description: structure of the h3-h4 chaperone asf1 bound to histones h3 and h4

PDB Compounds: (C:) histone h4

SCOPe Domain Sequences for d2huec_:

Sequence; same for both SEQRES and ATOM records:

>d2huec_ a.22.1.1 (C:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfg

Timeline for d2huec_:

• d2huec_ first appeared in SCOP 1.73, called d2huec1
  
• d2huec_ appears in SCOPe 2.04
  
• d2huec_ appears in SCOPe 2.06
  
• d2huec_ appears in the current release, SCOPe 2.08