Lineage for d2huec_ (2hue C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 2310580Protein Histone H4 [47125] (7 species)
  7. 2310581Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (41 PDB entries)
  8. 2310582Domain d2huec_: 2hue C: [136776]
    Other proteins in same PDB: d2huea1, d2huea2, d2hueb1, d2hueb2
    automated match to d1aoif_
    complexed with gol, so4, zn

Details for d2huec_

PDB Entry: 2hue (more details), 1.7 Å

PDB Description: structure of the h3-h4 chaperone asf1 bound to histones h3 and h4
PDB Compounds: (C:) histone h4

SCOPe Domain Sequences for d2huec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2huec_ a.22.1.1 (C:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfg

SCOPe Domain Coordinates for d2huec_:

Click to download the PDB-style file with coordinates for d2huec_.
(The format of our PDB-style files is described here.)

Timeline for d2huec_: