Lineage for d2huec1 (2hue C:20-101)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637645Protein Histone H4 [47125] (4 species)
  7. 637646Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (28 PDB entries)
  8. 637647Domain d2huec1: 2hue C:20-101 [136776]
    automatically matched to d1p3gf_
    complexed with gol, so4, zn; mutant

Details for d2huec1

PDB Entry: 2hue (more details), 1.7 Å

PDB Description: structure of the h3-h4 chaperone asf1 bound to histones h3 and h4
PDB Compounds: (C:) histone h4

SCOP Domain Sequences for d2huec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfg

SCOP Domain Coordinates for d2huec1:

Click to download the PDB-style file with coordinates for d2huec1.
(The format of our PDB-style files is described here.)

Timeline for d2huec1: