SCOPe 2.04: Domain d2hrya3: 2hry A:167-345

Lineage for d2hrya3 (2hry A:167-345)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)

6. Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
   duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer

7. Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries)
   TM1246

8. Domain d2hrya3: 2hry A:167-345 [136706]
   Other proteins in same PDB: d2hrya1, d2hrya2
   automated match to d1vk3a3
   complexed with acp, mg, po4

Details for d2hrya3

PDB Entry: 2hry, 2.8 Å

PDB Description: t. maritima purl complexed with amppcp

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hrya3:

Sequence, based on SEQRES records:

>d2hrya3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Sequence, based on observed residues (ATOM records):

>d2hrya3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
kasrpgqvivifggatgrdgivgdpfaekmlieaflemveeglvegaqdlgaggvlsats
elvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiarkhllf
gdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Timeline for d2hrya3:

• d2hrya3 first appeared in SCOP 1.73
  
• d2hrya3 appears in SCOPe 2.03
  
• d2hrya3 appears in SCOPe 2.05
  
• d2hrya3 appears in the current release, SCOPe 2.08