Lineage for d2hrya4 (2hry A:508-603)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1670756Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 1670757Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 1670758Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 1670785Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 1670786Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries)
    TM1246
  8. 1670796Domain d2hrya4: 2hry A:508-603 [136707]
    Other proteins in same PDB: d2hrya1, d2hrya2
    automated match to d1vk3a4
    complexed with acp, mg, po4

Details for d2hrya4

PDB Entry: 2hry (more details), 2.8 Å

PDB Description: t. maritima purl complexed with amppcp
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hrya4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrya4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki
evklpevrpahqmvlvfsertpvvdvpvkeigtlsr

SCOPe Domain Coordinates for d2hrya4:

Click to download the PDB-style file with coordinates for d2hrya4.
(The format of our PDB-style files is described here.)

Timeline for d2hrya4: