SCOPe 2.04: Domain d2hoea3: 2hoe A:72-199

Lineage for d2hoea3 (2hoe A:72-199)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.10: ROK [110636] (8 proteins)
   Pfam PF00480

6. Protein N-acetylglucosamine kinase [142469] (1 species)
   Transcriptional regulator, XylR-related

7. Species Thermotoga maritima [TaxId:2336] [142470] (1 PDB entry)
   Uniprot Q9X0V1 200-368! Uniprot Q9X0V1 72-199
   TM1224

8. Domain d2hoea3: 2hoe A:72-199 [136641]
   Other proteins in same PDB: d2hoea1
   complexed with gol, k

Details for d2hoea3

PDB Entry: 2hoe, 2.46 Å

PDB Description: crystal structure of n-acetylglucosamine kinase (tm1224) from thermotoga maritima at 2.46 a resolution

PDB Compounds: (A:) N-acetylglucosamine kinase

SCOPe Domain Sequences for d2hoea3:

Sequence; same for both SEQRES and ATOM records:

>d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]}
pncayvlgievtrdeiaaclidasmnilaheahplpsqsdreetlnvmyriidrakdmme
klgsklsaltvaapgpidtergiiidprnfplsqiplanllkekygievwvendadmgav
gekwytkr

Timeline for d2hoea3:

• d2hoea3 first appeared in SCOP 1.73
  
• d2hoea3 appears in SCOPe 2.03
  
• d2hoea3 appears in SCOPe 2.05
  
• d2hoea3 appears in the current release, SCOPe 2.08